The Tutorial of MetaMHCpan Predictions

For the time being, this server online can predict peptides binding to more than 600 other MHC class II moleculars. The steps on how to make a prediction and what is the meaning of the result are as below.

A. How to obtain predictions

This is a screenshot of the input page. The numbers in red relate to the referring sections below.

the main frame
go back

1. choose method

In this place, you can choose one or more methods, you must choose one method except AvgTanh.

2. Input the protein sequence(s)

In the first place, you should specify the sequence(s) which you want to scan for the binding peptides. The sequences can either be typed directly into the text area, or can be uploaded from a file using the button. If both the text area and the file uploaded containing sequences, this server will treat them both as inputs and the sequence(s) in the uploaded file will be appended to the data in the text area.

Three types of formats are acceptable to this server:

By FASTA Format, long antignic protein sequences in one or multiple lines, each of which begins with '>', are allowed. The lines starting with '>' are treated as the names of the following sequences. In prediction, these sequence are splitted into peptides with the fixed length you specify. The other format, i.e. PEPTIDE, you can input peptides with variable length (at least 9) directly. Then the length option has no sense for the server will give direct predictions for these variable-length peptides.

All sequences have to be amino acids specified in single letter code (ACDEFGHIKLMNPQRSTVWY) and other letter code (BUXZ*) will be pointed out before being ignored by the input processor. The server will ignore any other non-white space characters beside them. If the number of the legal characters in a sequence is under nine, this sequence will be ignored for too short as a binding peptide.

If you have trouble in choosing protein sequences or deciding the suitable format, the web page provides examples for each format. Please click the "show an example" to provide an example for the selected format.

If your input format is FASTA, you can choose a peptide length.

go back

3. Input MHC molecules

The target species/loci can be chose in the first list box.

In the second list box, you can choose a allele.

    For prediction for novel allele by inputing MHC sequence, it's required to input complete MHC sequence in FASTA format, or align your sequence to the complete sequence given below to make it complete with "-" padding.

">HLA-DRB*01:01
MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTEL GRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGA GLFIYFRNQKGHSGLQPTGFLS"

    Simply, you can enable the checkbox above and click "show example" in the server page. A example sequence is ready for you. Feel free to try and summit.

go back

4. Choose output interface

This server provides two types of output interfaces for different users. The "Webpage" interface which is friendly to ordinary users will show all the result on a dynamic web page implemented with javascript and PHP technology. The "Text" interface provides the result directly in a plain text format which is friendly to computer programs.

When all the above have been done, press the "Submit" button to process the prediction.

The time cost of the prediction depends on the number of input data points. The time having passed during the prediction will be shown on the web page.

the state of processing

B. Interpreting prediction output

When the prediction has finished, the processing page will automatically change to the result page.

the result page
go back

1. Information about prediction

The board shows some basic information during the prediction such as which alleles, the size of the input and how long the prediction processed.

go back

2. The sequences in the input

Each row contains the name and the full sequence of the referring protein.

go back

3. Show or hidden rank

your can click this two button to show or hidden rank.

go back

4. Scores of predictors

The scores are obtained according to the method you choose. Higher scores means more likely stronger binding between the peptide and allele molecular.

go back

5. View the prediction results

If your browser supports javascript, the DataTable will work. Then you can click the column headers to sort the table. you can search the result.

Sort the table by the scores of MHC2SKpan sort the table
Search search the table

© 2014 DMIIP, All Rights Reserved